PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_D934D0099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 348aa    MW: 35855.4 Da    PI: 9.7699
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_D934D0099.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-3879136360
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                            ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Traes_5BL_D934D0099.1  79 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 136
                            66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.4E-3281135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09682136IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2582133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MIQELLGGTA MEQQQLKCAG NAANHHGSLP MALQPISSNP SPTSSSTSSR SSTQRSPSAA  60
SSPQGQGQQG QQGPPGPEQA PLRCPRCNSS NTKFCYYNNY NLTQPRHFCK TCRRYWTKGG  120
ALRNVPIGGG CRKPRPMPAP VAKAQPSSCK SVLGMGVGTA PSLGLGMGVG GGMSWASSPQ  180
TATAQLMALL NSARAGYAGS NMHRLLGLDT MGQLQVLPGS ANGGPGMSPS LWPQATHRPT  240
MPPPPMHLDS HLGMGSLGLG QGQGHHNLLS ALELKPPSSS PSPSSLAASY YSDQLNAVVS  300
NGGAGRPHPY DTPASSYPCS TAMCSLPPSA STVSAAQSSR TVGMDQQP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843630.0AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559395.11e-103PREDICTED: dof zinc finger protein DOF3.2
TrEMBLW5FIU50.0W5FIU5_WHEAT; Uncharacterized protein
STRINGMLOC_37654.11e-173(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-31OBF binding protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]